Lineage for d1g6vk_ (1g6v K:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102277Species Camel (Camelus dromedarius), antibody cab-ca05 [48916] (2 PDB entries)
  8. 102280Domain d1g6vk_: 1g6v K: [20513]
    Other proteins in same PDB: d1g6va_

Details for d1g6vk_

PDB Entry: 1g6v (more details), 3.5 Å

PDB Description: Complex of the camelid heavy-chain antibody fragment CAB-CA05 with bovine carbonic anhydrase

SCOP Domain Sequences for d1g6vk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6vk_ b.1.1.1 (K:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), antibody cab-ca05}
qvqlvesgggsvqaggslrlscaasgytvstycmgwfrqapgkeregvatilggstyygd
svkgrftisqdnakntvylqmnslkpedtaiyycagstvastgwcsrlrpydyhyrgqgt
qvtvss

SCOP Domain Coordinates for d1g6vk_:

Click to download the PDB-style file with coordinates for d1g6vk_.
(The format of our PDB-style files is described here.)

Timeline for d1g6vk_: