SCOPe 2.05: Domain d2noga1: 2nog A:739-827

Lineage for d2noga1 (2nog A:739-827)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.187: HAND domain of the nucleosome remodeling ATPase ISWI [101223] (1 superfamily)
   4 helices; irregular array

4. Superfamily a.187.1: HAND domain of the nucleosome remodeling ATPase ISWI [101224] (2 families)
   automatically mapped to Pfam PF09110

5. Family a.187.1.0: automated matches [227213] (1 protein)
   not a true family

6. Protein automated matches [226949] (1 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [225307] (1 PDB entry)

8. Domain d2noga1: 2nog A:739-827 [205124]
   Other proteins in same PDB: d2nogb2
   automated match to d1ofcx3
   complexed with mg

Details for d2noga1

PDB Entry: 2nog, 2 Å

PDB Description: SANT Domain Structure of Xenopus Remodeling Factor ISWI

PDB Compounds: (A:) iswi protein

SCOPe Domain Sequences for d2noga1:

Sequence; same for both SEQRES and ATOM records:

>d2noga1 a.187.1.0 (A:739-827) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
epkvpkaprppkqpnvqdfqffpprlfellekeilyyrktigykvprnpdlpnsaqvqke
eqlkideaeplndeeleekeklltqgft

Timeline for d2noga1:

• d2noga1 first appeared in SCOPe 2.03
  
• d2noga1 appears in SCOPe 2.04
  
• d2noga1 appears in SCOPe 2.06
  
• d2noga1 appears in the current release, SCOPe 2.08