Lineage for d1f2xl_ (1f2x L:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102277Species Camel (Camelus dromedarius), antibody cab-ca05 [48916] (2 PDB entries)
  8. 102279Domain d1f2xl_: 1f2x L: [20512]

Details for d1f2xl_

PDB Entry: 1f2x (more details), 2.1 Å

PDB Description: structure of the single-domain camelid antibody cab-ca05

SCOP Domain Sequences for d1f2xl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2xl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), antibody cab-ca05}
vqlvesgggsvqaggslrlscaasgytvstycmgwfrqapgkeregvatilggstyygds
vkgrftisqdnakntvylqmnslkpedtaiyycagstvastgwcsrlrpydyhyrgqgtq
vtvssr

SCOP Domain Coordinates for d1f2xl_:

Click to download the PDB-style file with coordinates for d1f2xl_.
(The format of our PDB-style files is described here.)

Timeline for d1f2xl_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f2xk_