Lineage for d2nljc_ (2nlj C:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1956602Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 1956603Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) (S)
  5. 1956604Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 1956625Protein Potassium channel protein [56901] (2 species)
  7. 1956665Species Streptomyces lividans [TaxId:1916] [161074] (20 PDB entries)
  8. 1956671Domain d2nljc_: 2nlj C: [205117]
    Other proteins in same PDB: d2nlja1, d2nlja2, d2nljb1, d2nljb2
    automated match to d1s5hc_
    complexed with dga, k

Details for d2nljc_

PDB Entry: 2nlj (more details), 2.52 Å

PDB Description: potassium channel kcsa(m96v)-fab complex in kcl
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2nljc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nljc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvvvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d2nljc_:

Click to download the PDB-style file with coordinates for d2nljc_.
(The format of our PDB-style files is described here.)

Timeline for d2nljc_: