SCOPe 2.04: Domain d2jkvf1: 2jkv F:2-177

Lineage for d2jkvf1 (2jkv F:2-177)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (37 PDB entries)

8. Domain d2jkvf1: 2jkv F:2-177 [205103]
   Other proteins in same PDB: d2jkva2, d2jkvb2, d2jkvc2, d2jkvd2, d2jkve2, d2jkvf2
   automated match to d1pgja2
   complexed with cl, nap, so4

Details for d2jkvf1

PDB Entry: 2jkv, 2.53 Å

PDB Description: structure of human phosphogluconate dehydrogenase in complex with nadph at 2.53a

PDB Compounds: (F:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2jkvf1:

Sequence; same for both SEQRES and ATOM records:

>d2jkvf1 c.2.1.0 (F:2-177) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvgaqslkem
vsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcrdlkakgi
lfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwvgde

Timeline for d2jkvf1:

• d2jkvf1 first appeared in SCOPe 2.03
  
• d2jkvf1 appears in SCOPe 2.05
  
• d2jkvf1 appears in the current release, SCOPe 2.08