Lineage for d1bzqn_ (1bzq N:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102272Species Camel (Camelus dromedarius), anti-RNase A antibody [48915] (1 PDB entry)
  8. 102276Domain d1bzqn_: 1bzq N: [20510]
    Other proteins in same PDB: d1bzqa_, d1bzqb_, d1bzqc_, d1bzqd_

Details for d1bzqn_

PDB Entry: 1bzq (more details), 2.8 Å

PDB Description: complex of a dromedary single-domain vhh antibody fragment with rnase a

SCOP Domain Sequences for d1bzqn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzqn_ b.1.1.1 (N:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), anti-RNase A antibody}
qvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
srgr

SCOP Domain Coordinates for d1bzqn_:

Click to download the PDB-style file with coordinates for d1bzqn_.
(The format of our PDB-style files is described here.)

Timeline for d1bzqn_: