Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Camel (Camelus dromedarius), anti-RNase A antibody [48915] (1 PDB entry) |
Domain d1bzqn_: 1bzq N: [20510] Other proteins in same PDB: d1bzqa_, d1bzqb_, d1bzqc_, d1bzqd_ |
PDB Entry: 1bzq (more details), 2.8 Å
SCOP Domain Sequences for d1bzqn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bzqn_ b.1.1.1 (N:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), anti-RNase A antibody} qvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs srgr
Timeline for d1bzqn_: