Lineage for d2jkvc1 (2jkv C:2-177)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831330Species Human (Homo sapiens) [TaxId:9606] [186944] (39 PDB entries)
  8. 1831365Domain d2jkvc1: 2jkv C:2-177 [205097]
    Other proteins in same PDB: d2jkva2, d2jkvb2, d2jkvc2, d2jkvd2, d2jkve2, d2jkvf2
    automated match to d1pgja2
    complexed with cl, nap, so4

Details for d2jkvc1

PDB Entry: 2jkv (more details), 2.53 Å

PDB Description: structure of human phosphogluconate dehydrogenase in complex with nadph at 2.53a
PDB Compounds: (C:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2jkvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jkvc1 c.2.1.0 (C:2-177) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvgaqslkem
vsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcrdlkakgi
lfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwvgde

SCOPe Domain Coordinates for d2jkvc1:

Click to download the PDB-style file with coordinates for d2jkvc1.
(The format of our PDB-style files is described here.)

Timeline for d2jkvc1: