Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (181 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186944] (37 PDB entries) |
Domain d2jkvb1: 2jkv B:2-177 [205095] Other proteins in same PDB: d2jkva2, d2jkvb2, d2jkvc2, d2jkvd2, d2jkve2, d2jkvf2 automated match to d1pgja2 complexed with cl, nap, so4 |
PDB Entry: 2jkv (more details), 2.53 Å
SCOPe Domain Sequences for d2jkvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jkvb1 c.2.1.0 (B:2-177) automated matches {Human (Homo sapiens) [TaxId: 9606]} aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvgaqslkem vsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcrdlkakgi lfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwvgde
Timeline for d2jkvb1: