Class a: All alpha proteins [46456] (284 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (23 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225061] (10 PDB entries) |
Domain d2jkva2: 2jkv A:178-483 [205094] Other proteins in same PDB: d2jkva1, d2jkvb1, d2jkvc1, d2jkvd1, d2jkve1, d2jkvf1 automated match to d1pgja1 complexed with cl, nap, so4 |
PDB Entry: 2jkv (more details), 2.53 Å
SCOPe Domain Sequences for d2jkva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jkva2 a.100.1.0 (A:178-483) automated matches {Human (Homo sapiens) [TaxId: 9606]} gaghfvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflieita nilkfqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkder iqaskklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnygg ialmwrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgvqag ipmpcfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwtghggtvs sssyna
Timeline for d2jkva2: