Lineage for d1bzqm_ (1bzq M:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781558Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 781559Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (22 PDB entries)
    SQ NA # camelid antibody
  8. 781594Domain d1bzqm_: 1bzq M: [20509]
    Other proteins in same PDB: d1bzqa_, d1bzqb_, d1bzqc_, d1bzqd_
    anti-RNase A VHh domain

Details for d1bzqm_

PDB Entry: 1bzq (more details), 2.8 Å

PDB Description: complex of a dromedary single-domain vhh antibody fragment with rnase a
PDB Compounds: (M:) protein (antibody cab-rn05)

SCOP Domain Sequences for d1bzqm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzqm_ b.1.1.1 (M:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
srgr

SCOP Domain Coordinates for d1bzqm_:

Click to download the PDB-style file with coordinates for d1bzqm_.
(The format of our PDB-style files is described here.)

Timeline for d1bzqm_: