Lineage for d1bzqm_ (1bzq M:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219294Species Camel (Camelus dromedarius), anti-RNase A antibody [48915] (1 PDB entry)
    single-domain VH fragment
  8. 219297Domain d1bzqm_: 1bzq M: [20509]
    Other proteins in same PDB: d1bzqa_, d1bzqb_, d1bzqc_, d1bzqd_

Details for d1bzqm_

PDB Entry: 1bzq (more details), 2.8 Å

PDB Description: complex of a dromedary single-domain vhh antibody fragment with rnase a

SCOP Domain Sequences for d1bzqm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzqm_ b.1.1.1 (M:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), anti-RNase A antibody}
qvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
srgr

SCOP Domain Coordinates for d1bzqm_:

Click to download the PDB-style file with coordinates for d1bzqm_.
(The format of our PDB-style files is described here.)

Timeline for d1bzqm_: