Lineage for d1bzql_ (1bzq L:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7266Species Camel (Camelus dromedarius), anti-RNase A antibody [48915] (1 PDB entry)
  8. 7268Domain d1bzql_: 1bzq L: [20508]
    Other proteins in same PDB: d1bzqa_, d1bzqb_, d1bzqc_, d1bzqd_

Details for d1bzql_

PDB Entry: 1bzq (more details), 2.8 Å

PDB Description: complex of a dromedary single-domain vhh antibody fragment with rnase a

SCOP Domain Sequences for d1bzql_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzql_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), anti-RNase A antibody}
qvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
srgr

SCOP Domain Coordinates for d1bzql_:

Click to download the PDB-style file with coordinates for d1bzql_.
(The format of our PDB-style files is described here.)

Timeline for d1bzql_: