SCOPe 2.03: Domain d2jk5c_: 2jk5 C:

Lineage for d2jk5c_ (2jk5 C:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein automated matches [190184] (2 species)
   not a true protein

7. Species Streptomyces lividans [TaxId:1916] [186922] (9 PDB entries)

8. Domain d2jk5c_: 2jk5 C: [205074]
   Other proteins in same PDB: d2jk5a1, d2jk5a2, d2jk5b1, d2jk5b2
   automated match to d1s5hc_
   complexed with co, f09, hp6, k, l2c, tba

Details for d2jk5c_

PDB Entry: 2jk5, 2.4 Å

PDB Description: Potassium Channel KcsA in complex with Tetrabutylammonium in high K

PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2jk5c_:

Sequence; same for both SEQRES and ATOM records:

>d2jk5c_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d2jk5c_:

• d2jk5c_ is new in SCOPe 2.03-stable
  
• d2jk5c_ appears in SCOPe 2.04
  
• d2jk5c_ appears in the current release, SCOPe 2.08