SCOPe 2.07: Domain d2jjvb_: 2jjv B:

Lineage for d2jjvb_ (2jjv B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d2jjvb_: 2jjv B: [205069]
   automated match to d2i26o_
   complexed with cl, so4

Details for d2jjvb_

PDB Entry: 2jjv, 1.8 Å

PDB Description: structure of human signal regulatory protein (sirp) beta(2)

PDB Compounds: (B:) signal-regulatory protein beta 1.

SCOPe Domain Sequences for d2jjvb_:

Sequence; same for both SEQRES and ATOM records:

>d2jjvb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eelqviqpdksisvaagesatlhctvtslipvgpiqwfrgagpgreliynqkeghfprvt
tvsdltkrnnmdfsirisnitpadagtyycvkfrkgspdhvefksgagtelsvra

Timeline for d2jjvb_:

• d2jjvb_ first appeared in SCOPe 2.03
  
• d2jjvb_ appears in SCOPe 2.06
  
• d2jjvb_ appears in the current release, SCOPe 2.08