Lineage for d1mela_ (1mel A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51922Species Camel (Camelus dromedarius), anti-lysozyme antibody [48914] (1 PDB entry)
  8. 51923Domain d1mela_: 1mel A: [20505]
    Other proteins in same PDB: d1mell_, d1melm_

Details for d1mela_

PDB Entry: 1mel (more details), 2.5 Å

PDB Description: crystal structure of a camel single-domain vh antibody fragment in complex with lysozyme

SCOP Domain Sequences for d1mela_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mela_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), anti-lysozyme antibody}
vqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityya
dsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygyd
swgqgtqvtvss

SCOP Domain Coordinates for d1mela_:

Click to download the PDB-style file with coordinates for d1mela_.
(The format of our PDB-style files is described here.)

Timeline for d1mela_: