Lineage for d2jgua2 (2jgu A:348-758)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1951566Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1951567Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1953148Family e.8.1.0: automated matches [227142] (1 protein)
    not a true family
  6. 1953149Protein automated matches [226844] (5 species)
    not a true protein
  7. 1953185Species Pyrococcus furiosus [TaxId:2261] [224944] (3 PDB entries)
  8. 1953189Domain d2jgua2: 2jgu A:348-758 [205040]
    Other proteins in same PDB: d2jgua1
    automated match to d2vwja2
    complexed with mn

Details for d2jgua2

PDB Entry: 2jgu (more details), 2.6 Å

PDB Description: crystal structure of dna-directed dna polymerase
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d2jgua2:

Sequence, based on SEQRES records: (download)

>d2jgua2 e.8.1.0 (A:348-758) automated matches {Pyrococcus furiosus [TaxId: 2261]}
stgnlvewfllrkayernevapnkpseeeyqrrlresytggfvkepekglwenivyldyk
slypsiiithnvspdtlnlegcknydiapqvghkfckdipgfipsllghlleerqkiktk
mketqdpiekilldyrqkaikllansfygyygyakarwyckecaesvtawgrkyielvwk
eleekfgfkvlyidtdglyatipggeseeikkkalefvkyinsklpglleleyegfykrg
ffvtkkryavideegkvitrgleivrrdwseiaketqarvletilkhgdveeavrivkev
iqklanyeippeklaiyeqitrplheykaigphvavakklaakgvkikpgmvigyivlrg
dgpisnrailaeeydpkkhkydaeyyienqvlpavlrilegfgyrkedlry

Sequence, based on observed residues (ATOM records): (download)

>d2jgua2 e.8.1.0 (A:348-758) automated matches {Pyrococcus furiosus [TaxId: 2261]}
stgnlvewfllrkayernevapnkpseeeyqrrlresytggfvkepekglwenivyldyk
slypsiiithnvspdtlnlegcknydiapqvghkfckdipgfipsllghlleerqkiktk
mketqdpiekilldyrqkaikllansfygyygyakarwyckecaesvtawgrkyielvwk
eleekfgfkvlyidtdglyatipggeseeikkkalefvkyinsklpglleleyegfykrg
ffvtkkryavideegkvitrgleseiaketqarvletilkhgdveeavrivkeviqklan
yeippeklaphvavakklaakgvkikpgmvigyivdaeyyienqvlpavlrilegfgyrk
edlry

SCOPe Domain Coordinates for d2jgua2:

Click to download the PDB-style file with coordinates for d2jgua2.
(The format of our PDB-style files is described here.)

Timeline for d2jgua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jgua1