Lineage for d1ehlh1 (1ehl H:1-113)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102158Species Anti-photoproduct Fab 64M-2, (mouse), kappa L chain [48912] (1 PDB entry)
  8. 102159Domain d1ehlh1: 1ehl H:1-113 [20503]
    Other proteins in same PDB: d1ehlh2, d1ehll2

Details for d1ehlh1

PDB Entry: 1ehl (more details), 2.4 Å

PDB Description: 64m-2 antibody fab complexed with d(5ht)(6-4)t

SCOP Domain Sequences for d1ehlh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehlh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-photoproduct Fab 64M-2, (mouse), kappa L chain}
evqlqqsgtvlarpgasvkmsckasgysftsfwmhwvkqrpgqglewigtiypgnsdtsy
nqkfkgkakltavtsastaymevssltnedsavyyctrrsgykyyaldywgqgtsvtvss

SCOP Domain Coordinates for d1ehlh1:

Click to download the PDB-style file with coordinates for d1ehlh1.
(The format of our PDB-style files is described here.)

Timeline for d1ehlh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ehlh2