SCOPe 2.08: Domain d2jg1d1: 2jg1 D:1-310

Lineage for d2jg1d1 (2jg1 D:1-310)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (50 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [225257] (2 PDB entries)

8. Domain d2jg1d1: 2jg1 D:1-310 [205025]
   Other proteins in same PDB: d2jg1a2, d2jg1b2, d2jg1c2, d2jg1d2
   automated match to d2awdb_
   complexed with anp, mg, ta6

Details for d2jg1d1

PDB Entry: 2jg1, 2 Å

PDB Description: structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate

PDB Compounds: (D:) tagatose-6-phosphate kinase

SCOPe Domain Sequences for d2jg1d1:

Sequence; same for both SEQRES and ATOM records:

>d2jg1d1 c.72.1.0 (D:1-310) automated matches {Staphylococcus aureus [TaxId: 93061]}
miltltlnpsvdisypltalklddvnrvqevsktaggkglnvtrvlaqvgepvlasgfig
gelgqfiakkldhadikhafynikgetrnciailhegqqteileqgpeidnqeaagfikh
feqmmekveavaisgslpkglnqdyyaqiiercqnkgvpvildcsgatlqtvlenpykpt
vikpniselyqllnqpldesleslkqavsqplfegiewiivslgaqgafakhnhtfyrvn
iptisvlnpvgsgdstvagitsailnhendhdllkkantlgmlnaqeaqtgyvnlnnydd
lfnqievlev

Timeline for d2jg1d1:

• d2jg1d1 first appeared in SCOPe 2.03, called d2jg1d_
  
• d2jg1d1 appears in SCOPe 2.07