SCOPe 2.03: Domain d1ehll1: 1ehl L:1-107

Lineage for d1ehll1 (1ehl L:1-107)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (131 PDB entries)
   Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10

8. Domain d1ehll1: 1ehl L:1-107 [20502]
   Other proteins in same PDB: d1ehlh1, d1ehlh2, d1ehll2
   part of anti-photoproduct Fab 64M-2
   protein/DNA complex

Details for d1ehll1

PDB Entry: 1ehl, 2.4 Å

PDB Description: 64m-2 antibody fab complexed with d(5ht)(6-4)t

PDB Compounds: (L:) anti-(6-4) photoproduct antibody 64m-2 fab (light chain)

SCOPe Domain Sequences for d1ehll1:

Sequence; same for both SEQRES and ATOM records:

>d1ehll1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgslvptfgggtkleik

Timeline for d1ehll1:

• d1ehll1 first appeared (with stable ids) in SCOP 1.55
  
• d1ehll1 appears in SCOPe 2.02
  
• d1ehll1 appears in SCOPe 2.04
  
• d1ehll1 appears in the current release, SCOPe 2.08