SCOPe 2.08: Domain d2jcna_: 2jcn A:

Lineage for d2jcna_ (2jcn A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.0: automated matches [195065] (1 protein)
   not a true family

6. Protein automated matches [195066] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225196] (14 PDB entries)

8. Domain d2jcna_: 2jcn A: [205017]
   automated match to d4aq3b_
   complexed with so4

Details for d2jcna_

PDB Entry: 2jcn, 1.8 Å

PDB Description: the crystal structure of bak1 - a mitochondrial apoptosis regulator

PDB Compounds: (A:) bcl-2 homologous antagonist/killer

SCOPe Domain Sequences for d2jcna_:

Sequence, based on SEQRES records:

>d2jcna_ f.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seeqvaqdteevfrsyvfyrhqqeqeaegvaapadpemvtlplqpsstmgqvgrqlaiig
ddinrrydsefqtmlqhlqptaenayeyftkiatslfesginwgrvvallgfgyrlalhv
yqhgltgflgqvtrfvvdfmlhhciarwiaqrggwvaalnlg

Sequence, based on observed residues (ATOM records):

>d2jcna_ f.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seeqvaqdteevfrsyvfyrhqqeqeapadpemvtlplqpsstmgqvgrqlaiigddinr
rydsefqtmlqhlqptaenayeyftkiatslfesginwgrvvallgfgyrlalhvyqhgl
tgflgqvtrfvvdfmlhhciarwiaqrggwvaalnlg

Timeline for d2jcna_:

• d2jcna_ first appeared in SCOPe 2.03
  
• d2jcna_ appears in SCOPe 2.07