Lineage for d1egjh1 (1egj H:1-113)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157986Species Fab against cytokyne receptor common beta chain domain 4, (mouse), kappa L chain [48911] (1 PDB entry)
  8. 157987Domain d1egjh1: 1egj H:1-113 [20501]
    Other proteins in same PDB: d1egja_, d1egjh2, d1egjl2

Details for d1egjh1

PDB Entry: 1egj (more details), 2.8 Å

PDB Description: domain 4 of the beta common chain in complex with an antibody
PDB Compounds: (H:)

SCOP Domain Sequences for d1egjh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egjh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab against cytokyne receptor common beta chain domain 4, (mouse), kappa L chain}
evqlqqsgpelvkpgtsvkmsckasgytftdyymkwvkhshgkslewigdinpsnggtly
nqkfkgkatltvdkssstasmqlsrltsedsavyycsrgdgihggfaywgqgttvtvss

SCOP Domain Coordinates for d1egjh1:

Click to download the PDB-style file with coordinates for d1egjh1.
(The format of our PDB-style files is described here.)

Timeline for d1egjh1: