| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species Fab against cytokyne receptor common beta chain domain 4, (mouse), kappa L chain [48911] (1 PDB entry) |
| Domain d1egjh1: 1egj H:1-113 [20501] Other proteins in same PDB: d1egja_, d1egjh2, d1egjl2 |
PDB Entry: 1egj (more details), 2.8 Å
SCOP Domain Sequences for d1egjh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1egjh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab against cytokyne receptor common beta chain domain 4, (mouse), kappa L chain}
evqlqqsgpelvkpgtsvkmsckasgytftdyymkwvkhshgkslewigdinpsnggtly
nqkfkgkatltvdkssstasmqlsrltsedsavyycsrgdgihggfaywgqgttvtvss
Timeline for d1egjh1: