SCOP 1.59: Domain d1egjl1: 1egj L:1-107

Lineage for d1egjl1 (1egj L:1-107)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fab against cytokyne receptor common beta chain domain 4, (mouse), kappa L chain [48911] (1 PDB entry)

8. Domain d1egjl1: 1egj L:1-107 [20500]
   Other proteins in same PDB: d1egja_, d1egjh2, d1egjl2

Details for d1egjl1

PDB Entry: 1egj, 2.8 Å

PDB Description: domain 4 of the beta common chain in complex with an antibody

SCOP Domain Sequences for d1egjl1:

Sequence; same for both SEQRES and ATOM records:

>d1egjl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab against cytokyne receptor common beta chain domain 4, (mouse), kappa L chain}
nivltqspaslavslgqratiscranesvysygdsfmhwyqqkpgqppklliylasnlas
gvparfsgsgsrtdftltidpvetddaatyycqqnnedpwtfgggtkleik

Timeline for d1egjl1:

• d1egjl1 first appeared (with stable ids) in SCOP 1.55
  
• d1egjl1 appears in SCOP 1.57
  
• d1egjl1 appears in SCOP 1.61
  
• d1egjl1 appears in the current release, SCOPe 2.08