Lineage for d1e6jh1 (1e6j H:1-120)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1288122Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (177 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 1288274Domain d1e6jh1: 1e6j H:1-120 [20497]
    Other proteins in same PDB: d1e6jh2, d1e6jl1, d1e6jl2, d1e6jp1, d1e6jp2
    part of Fab 13B5 against HIV-1 capsid protein p24

Details for d1e6jh1

PDB Entry: 1e6j (more details), 3 Å

PDB Description: crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5
PDB Compounds: (H:) immunoglobulin

SCOPe Domain Sequences for d1e6jh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6jh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqlqqsgaelarpgasvkmsckasgytftsytmhwvkqrpgqglewigyinpssgysny
nqkfkdkatltadkssstaymqlssltsedsavyycsrpvvrlgynfdywgqgstltvss

SCOPe Domain Coordinates for d1e6jh1:

Click to download the PDB-style file with coordinates for d1e6jh1.
(The format of our PDB-style files is described here.)

Timeline for d1e6jh1: