Lineage for d1e6jh1 (1e6j H:1-120)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363037Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (141 PDB entries)
  8. 363163Domain d1e6jh1: 1e6j H:1-120 [20497]
    Other proteins in same PDB: d1e6jh2, d1e6jl1, d1e6jl2, d1e6jp1, d1e6jp2
    part of Fab 13B5 against HIV-1 capsid protein p24
    mutant

Details for d1e6jh1

PDB Entry: 1e6j (more details), 3 Å

PDB Description: crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5

SCOP Domain Sequences for d1e6jh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6jh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
evqlqqsgaelarpgasvkmsckasgytftsytmhwvkqrpgqglewigyinpssgysny
nqkfkdkatltadkssstaymqlssltsedsavyycsrpvvrlgynfdywgqgstltvss

SCOP Domain Coordinates for d1e6jh1:

Click to download the PDB-style file with coordinates for d1e6jh1.
(The format of our PDB-style files is described here.)

Timeline for d1e6jh1: