SCOPe 2.08: Domain d1e6jh1: 1e6j H:1-120

Lineage for d1e6jh1 (1e6j H:1-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (181 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1e6jh1: 1e6j H:1-120 [20497]
   Other proteins in same PDB: d1e6jh2, d1e6jl1, d1e6jl2, d1e6jp1, d1e6jp2
   part of Fab 13B5 against HIV-1 capsid protein p24

Details for d1e6jh1

PDB Entry: 1e6j, 3 Å

PDB Description: crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5

PDB Compounds: (H:) immunoglobulin

SCOPe Domain Sequences for d1e6jh1:

Sequence; same for both SEQRES and ATOM records:

>d1e6jh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqlqqsgaelarpgasvkmsckasgytftsytmhwvkqrpgqglewigyinpssgysny
nqkfkdkatltadkssstaymqlssltsedsavyycsrpvvrlgynfdywgqgstltvss

Timeline for d1e6jh1:

• d1e6jh1 first appeared (with stable ids) in SCOP 1.55
  
• d1e6jh1 appears in SCOPe 2.07