Lineage for d2j60c_ (2j60 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3002834Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 3002835Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 3002936Family d.171.1.0: automated matches [191465] (1 protein)
    not a true family
  6. 3002937Protein automated matches [190726] (1 species)
    not a true protein
  7. 3002938Species Human (Homo sapiens) [TaxId:9606] [187887] (56 PDB entries)
  8. 3002971Domain d2j60c_: 2j60 C: [204956]
    automated match to d2j5zc_
    complexed with abe, act, ca

Details for d2j60c_

PDB Entry: 2j60 (more details), 1.8 Å

PDB Description: h-ficolin complexed to d-fucose
PDB Compounds: (C:) ficolin-3

SCOPe Domain Sequences for d2j60c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j60c_ d.171.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gprncrellsqgatlsgwyhlclpegralpvfcdmdtegggwlvfqrrqdgsvdffrsws
syragfgnqesefwlgnenlhqltlqgnwelrveledfngnrtfahyatfrllgevdhyq
lalgkfsegtagdslslhsgrpfttydadhdssnsncavivhgawwyascyrsnlngrya
vseaaahkygidwasgrgvghpyrrvrmmlr

SCOPe Domain Coordinates for d2j60c_:

Click to download the PDB-style file with coordinates for d2j60c_.
(The format of our PDB-style files is described here.)

Timeline for d2j60c_: