Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily) unusual fold |
Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) |
Family d.171.1.0: automated matches [191465] (1 protein) not a true family |
Protein automated matches [190726] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187887] (56 PDB entries) |
Domain d2j60c_: 2j60 C: [204956] automated match to d2j5zc_ complexed with abe, act, ca |
PDB Entry: 2j60 (more details), 1.8 Å
SCOPe Domain Sequences for d2j60c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j60c_ d.171.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gprncrellsqgatlsgwyhlclpegralpvfcdmdtegggwlvfqrrqdgsvdffrsws syragfgnqesefwlgnenlhqltlqgnwelrveledfngnrtfahyatfrllgevdhyq lalgkfsegtagdslslhsgrpfttydadhdssnsncavivhgawwyascyrsnlngrya vseaaahkygidwasgrgvghpyrrvrmmlr
Timeline for d2j60c_: