SCOPe 2.02: Domain d1e6ol1: 1e6o L:1-105

Lineage for d1e6ol1 (1e6o L:1-105)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (15 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.4 [TaxId:10090] [88530] (6 PDB entries)

8. Domain d1e6ol1: 1e6o L:1-105 [20494]
   Other proteins in same PDB: d1e6oh1, d1e6oh2, d1e6ol2
   part of Fab 13B5 against HIV-1 capsid protein p24

Details for d1e6ol1

PDB Entry: 1e6o, 1.8 Å

PDB Description: crystal structure of fab13b5 against hiv-1 capsid protein p24

PDB Compounds: (L:) immunoglobulin light chain

SCOPe Domain Sequences for d1e6ol1:

Sequence; same for both SEQRES and ATOM records:

>d1e6ol1 b.1.1.1 (L:1-105) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.4 [TaxId: 10090]}
eivltqspaitaaslgqkvtitcsasssvsymhwyqqksgtspkpwiyeisklasgvpar
fsgsgsgtsysltissmeaedaaiyycqqwnypftfgsgtkleik

Timeline for d1e6ol1:

• d1e6ol1 first appeared (with stable ids) in SCOP 1.55
  
• d1e6ol1 appears in SCOPe 2.01
  
• d1e6ol1 appears in SCOPe 2.03
  
• d1e6ol1 appears in the current release, SCOPe 2.08