Lineage for d1e6ol1 (1e6o L:1-105)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7327Species Fab 13B5 against HIV-1 capsid protein p24, (mouse), kappa L chain [48909] (2 PDB entries)
  8. 7329Domain d1e6ol1: 1e6o L:1-105 [20494]
    Other proteins in same PDB: d1e6oh2, d1e6ol2

Details for d1e6ol1

PDB Entry: 1e6o (more details), 1.8 Å

PDB Description: crystal structure of fab13b5 against hiv-1 capsid protein p24

SCOP Domain Sequences for d1e6ol1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6ol1 b.1.1.1 (L:1-105) Immunoglobulin (variable domains of L and H chains) {Fab 13B5 against HIV-1 capsid protein p24, (mouse), kappa L chain}
eivltqspaitaaslgqkvtitcsasssvsymhwyqqksgtspkpwiyeisklasgvpar
fsgsgsgtsysltissmeaedaaiyycqqwnypftfgsgtkleik

SCOP Domain Coordinates for d1e6ol1:

Click to download the PDB-style file with coordinates for d1e6ol1.
(The format of our PDB-style files is described here.)

Timeline for d1e6ol1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e6ol2