Lineage for d1qoka2 (1qok A:162-267)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157459Species Anti-carcinoembryonic scFv MFE-23, (mouse), kappa L chain [48908] (1 PDB entry)
  8. 157461Domain d1qoka2: 1qok A:162-267 [20493]

Details for d1qoka2

PDB Entry: 1qok (more details), 2.4 Å

PDB Description: mfe-23 an anti-carcinoembryonic antigen single-chain fv antibody

SCOP Domain Sequences for d1qoka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qoka2 b.1.1.1 (A:162-267) Immunoglobulin (variable domains of L and H chains) {Anti-carcinoembryonic scFv MFE-23, (mouse), kappa L chain}
envltqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklwiystsnlasgvpar
fsgsgsgtsysltisrmeaedaatyycqqrssypltfgagtklelk

SCOP Domain Coordinates for d1qoka2:

Click to download the PDB-style file with coordinates for d1qoka2.
(The format of our PDB-style files is described here.)

Timeline for d1qoka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qoka1