Lineage for d2j0vb_ (2j0v B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2129222Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189883] (5 PDB entries)
  8. 2129227Domain d2j0vb_: 2j0v B: [204918]
    automated match to d2atxb_
    complexed with gdp, mg

Details for d2j0vb_

PDB Entry: 2j0v (more details), 1.78 Å

PDB Description: the crystal structure of arabidopsis thaliana rac7-rop9: the first ras superfamily gtpase from the plant kingdom
PDB Compounds: (B:) rac-like GTP-binding protein arac7

SCOPe Domain Sequences for d2j0vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0vb_ c.37.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gshmsvskfikcvtvgdgavgktcmlicytsnkfptdyiptvfdnfsanvavdgqivnlg
lwdtagqedysrlrplsyrgadifvlafsliskasyenvlkkwmpelrrfapnvpivlvg
tkldlrddkgyladhtnvitstqgeelrkqigaaayiecssktqqnvkavfdtaikvvlq
pprr

SCOPe Domain Coordinates for d2j0vb_:

Click to download the PDB-style file with coordinates for d2j0vb_.
(The format of our PDB-style files is described here.)

Timeline for d2j0vb_: