Lineage for d2izwc_ (2izw C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1334432Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1334633Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1335156Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 1335157Protein automated matches [190988] (3 species)
    not a true protein
  7. 1335169Species Ryegrass mottle virus [TaxId:119910] [225341] (1 PDB entry)
  8. 1335172Domain d2izwc_: 2izw C: [204914]
    automated match to d1smvc_

Details for d2izwc_

PDB Entry: 2izw (more details), 2.9 Å

PDB Description: crystal structure of ryegrass mottle virus
PDB Compounds: (C:) ryegrass mottle virus coat protein

SCOPe Domain Sequences for d2izwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izwc_ b.121.4.0 (C:) automated matches {Ryegrass mottle virus [TaxId: 119910]}
gqqptrqvtpvsapaamgtqityrgpqvvtqygditpaknsgslvrvtssatagtevsgt
vlfnvrnatelpwlsgqgsryskyrvryahftwepivgsntngevamamlydvadvtsit
ierlmqtrggtwgpiwsptrkrlsydpehaslpwylsgvssgaaagniqtpfqiawaaqs
slvsttlgrimaeylveltdpvdvtinq

SCOPe Domain Coordinates for d2izwc_:

Click to download the PDB-style file with coordinates for d2izwc_.
(The format of our PDB-style files is described here.)

Timeline for d2izwc_: