Lineage for d1dzbb2 (1dzb B:201-307)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653521Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)
  8. 653599Domain d1dzbb2: 1dzb B:201-307 [20491]
    Other proteins in same PDB: d1dzba1, d1dzbb1, d1dzbx_, d1dzby_
    part of anti-lysozyme scFv 1F9

Details for d1dzbb2

PDB Entry: 1dzb (more details), 2 Å

PDB Description: crystal structure of phage library-derived single-chain fv fragment 1f9 in complex with turkey egg-white lysozyme
PDB Compounds: (B:) scfv fragment 1f9

SCOP Domain Sequences for d1dzbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzbb2 b.1.1.1 (B:201-307) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dieltqspssmytslgervtitckasqdinsylrwfqqkpgkspktliyyatsladgvps
rfsgsgsgqdysltisslesddtttyyclqhgespytfgggtkleik

SCOP Domain Coordinates for d1dzbb2:

Click to download the PDB-style file with coordinates for d1dzbb2.
(The format of our PDB-style files is described here.)

Timeline for d1dzbb2: