SCOPe 2.08: Domain d2iz0c1: 2iz0 C:2-177

Lineage for d2iz0c1 (2iz0 C:2-177)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Lactococcus lactis [TaxId:1358] [225210] (4 PDB entries)

8. Domain d2iz0c1: 2iz0 C:2-177 [204904]
   Other proteins in same PDB: d2iz0a2, d2iz0b2, d2iz0b3, d2iz0c2
   automated match to d1pgja2
   complexed with atr, cl, edo, gol, nap, p33, peg, res

Details for d2iz0c1

PDB Entry: 2iz0, 2.6 Å

PDB Description: pex inhibitor-home data

PDB Compounds: (C:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2iz0c1:

Sequence; same for both SEQRES and ATOM records:

>d2iz0c1 c.2.1.0 (C:2-177) automated matches {Lactococcus lactis [TaxId: 1358]}
aqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktleefv
gslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaeladsgin
figtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymgan

Timeline for d2iz0c1:

• d2iz0c1 first appeared in SCOPe 2.03
  
• d2iz0c1 appears in SCOPe 2.07