SCOPe 2.05: Domain d2iypb2: 2iyp B:178-470

Lineage for d2iypb2 (2iyp B:178-470)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (30 species)
   not a true protein

7. Species Lactococcus lactis [TaxId:1358] [225211] (4 PDB entries)

8. Domain d2iypb2: 2iyp B:178-470 [204897]
   Other proteins in same PDB: d2iypa1, d2iypb1, d2iypc1
   automated match to d1pgja1
   complexed with 5rp, a2p, nap

Details for d2iypb2

PDB Entry: 2iyp, 2.79 Å

PDB Description: product rup

PDB Compounds: (B:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2iypb2:

Sequence; same for both SEQRES and ATOM records:

>d2iypb2 a.100.1.0 (B:178-470) automated matches {Lactococcus lactis [TaxId: 1358]}
gaghyvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitk
evlkrkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykde
rvkaskvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygt
iaqiwragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqag
tpiptftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyt

Timeline for d2iypb2:

• d2iypb2 first appeared in SCOPe 2.03
  
• d2iypb2 appears in SCOPe 2.04
  
• d2iypb2 appears in SCOPe 2.06
  
• d2iypb2 appears in the current release, SCOPe 2.08