Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (159 species) not a true protein |
Species Lactococcus lactis [TaxId:1358] [225210] (4 PDB entries) |
Domain d2iypb1: 2iyp B:0-177 [204896] Other proteins in same PDB: d2iypa2, d2iypb2, d2iypc2 automated match to d1pgja2 complexed with 5rp, a2p, nap |
PDB Entry: 2iyp (more details), 2.79 Å
SCOPe Domain Sequences for d2iypb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iypb1 c.2.1.0 (B:0-177) automated matches {Lactococcus lactis [TaxId: 1358]} hmaqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktlee fvgslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaeladsg infigtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymgan
Timeline for d2iypb1:
View in 3D Domains from other chains: (mouse over for more information) d2iypa1, d2iypa2, d2iypc1, d2iypc2 |