Lineage for d2iypa1 (2iyp A:1-177)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831510Species Lactococcus lactis [TaxId:1358] [225210] (4 PDB entries)
  8. 1831518Domain d2iypa1: 2iyp A:1-177 [204894]
    Other proteins in same PDB: d2iypa2, d2iypb2, d2iypc2
    automated match to d1pgja2
    complexed with 5rp, a2p, nap

Details for d2iypa1

PDB Entry: 2iyp (more details), 2.79 Å

PDB Description: product rup
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2iypa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iypa1 c.2.1.0 (A:1-177) automated matches {Lactococcus lactis [TaxId: 1358]}
maqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktleef
vgslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaeladsgi
nfigtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymgan

SCOPe Domain Coordinates for d2iypa1:

Click to download the PDB-style file with coordinates for d2iypa1.
(The format of our PDB-style files is described here.)

Timeline for d2iypa1: