SCOPe 2.04: Domain d2iypa1: 2iyp A:1-177

Lineage for d2iypa1 (2iyp A:1-177)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Lactococcus lactis [TaxId:1358] [225210] (4 PDB entries)

8. Domain d2iypa1: 2iyp A:1-177 [204894]
   Other proteins in same PDB: d2iypa2, d2iypb2, d2iypc2
   automated match to d1pgja2
   complexed with 5rp, a2p, nap

Details for d2iypa1

PDB Entry: 2iyp, 2.79 Å

PDB Description: product rup

PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2iypa1:

Sequence; same for both SEQRES and ATOM records:

>d2iypa1 c.2.1.0 (A:1-177) automated matches {Lactococcus lactis [TaxId: 1358]}
maqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktleef
vgslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaeladsgi
nfigtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymgan

Timeline for d2iypa1:

• d2iypa1 first appeared in SCOPe 2.03
  
• d2iypa1 appears in SCOPe 2.05
  
• d2iypa1 appears in the current release, SCOPe 2.08