Lineage for d1dzba2 (1dzb A:201-307)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219136Species Anti-lysozyme scFv 1F9, (mouse), kappa L chain [48907] (1 PDB entry)
  8. 219138Domain d1dzba2: 1dzb A:201-307 [20489]
    Other proteins in same PDB: d1dzbx_, d1dzby_

Details for d1dzba2

PDB Entry: 1dzb (more details), 2 Å

PDB Description: crystal structure of phage library-derived single-chain fv fragment 1f9 in complex with turkey egg-white lysozyme

SCOP Domain Sequences for d1dzba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzba2 b.1.1.1 (A:201-307) Immunoglobulin (variable domains of L and H chains) {Anti-lysozyme scFv 1F9, (mouse), kappa L chain}
dieltqspssmytslgervtitckasqdinsylrwfqqkpgkspktliyyatsladgvps
rfsgsgsgqdysltisslesddtttyyclqhgespytfgggtkleik

SCOP Domain Coordinates for d1dzba2:

Click to download the PDB-style file with coordinates for d1dzba2.
(The format of our PDB-style files is described here.)

Timeline for d1dzba2: