![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
![]() | Protein automated matches [190824] (8 species) not a true protein |
![]() | Species Achromobacter cycloclastes [TaxId:223] [225121] (3 PDB entries) |
![]() | Domain d2iwkb2: 2iwk B:467-597 [204874] Other proteins in same PDB: d2iwka1, d2iwkb1 automated match to d1fwxa1 complexed with ca, cl, cu, cuz, iod, na |
PDB Entry: 2iwk (more details), 1.7 Å
SCOPe Domain Sequences for d2iwkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iwkb2 b.6.1.0 (B:467-597) automated matches {Achromobacter cycloclastes [TaxId: 223]} svwdrndplwaetrkqaeadevdidewteavirdgnkvrvymtsvapsfsqpsftvkegd evtvivtnldeiddlthgftmgnhgvamevgpqqtssvtfvaanpgvywyycqwfchalh memrgrmfvep
Timeline for d2iwkb2: