![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.3: Nitrous oxide reductase, N-terminal domain [50974] (1 family) ![]() |
![]() | Family b.69.3.1: Nitrous oxide reductase, N-terminal domain [50975] (2 proteins) |
![]() | Protein automated matches [226900] (2 species) not a true protein |
![]() | Species Achromobacter cycloclastes [TaxId:223] [225120] (2 PDB entries) |
![]() | Domain d2iwkb1: 2iwk B:8-466 [204873] Other proteins in same PDB: d2iwka2, d2iwkb2 automated match to d1fwxa2 complexed with ca, cl, cu, cuz, iod, na |
PDB Entry: 2iwk (more details), 1.7 Å
SCOPe Domain Sequences for d2iwkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iwkb1 b.69.3.1 (B:8-466) automated matches {Achromobacter cycloclastes [TaxId: 223]} adgsvapgklddyygfwssgqtgemrilgipsmrelmrvpvfnrcsatgwgqtnesirih qrtmtektkkqlaangkkihdngdlhhvhmsftdgkydgrylfmndkantrvarvrcdvm ktdaileipnakgihgmrpqkwprsnyvfcngedeaplvndgstmtdvatyvniftavda dkwevawqvkvsgnldncdadyegkwafstsynsemgmtleemtksemdhvvvfniaeie kaikagqyeeingvkvvdgrkeakslftryipiannphgcnmapdrkhlcvagklsptvt vldvtkfdalfydnaeprsavvaepelglgplhtafdgrgnaytslfldsqvvkwnidea irayagekinpikdkldvqyqpghlktvmgetldaandwlvclckfskdrflnvgplkpe ndqlidisgdkmvlvhdgptfaephdaiavspsilpnir
Timeline for d2iwkb1: