Class b: All beta proteins [48724] (180 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.3: Nitrous oxide reductase, N-terminal domain [50974] (1 family) |
Family b.69.3.1: Nitrous oxide reductase, N-terminal domain [50975] (2 proteins) |
Protein automated matches [226900] (3 species) not a true protein |
Species Achromobacter cycloclastes [TaxId:223] [225120] (2 PDB entries) |
Domain d2iwfa1: 2iwf A:8-466 [204867] Other proteins in same PDB: d2iwfa2, d2iwfb2 automated match to d1fwxa2 complexed with ca, cl, cu, cuz, na |
PDB Entry: 2iwf (more details), 1.86 Å
SCOPe Domain Sequences for d2iwfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iwfa1 b.69.3.1 (A:8-466) automated matches {Achromobacter cycloclastes [TaxId: 223]} adgsvapgklddyygfwssgqtgemrilgipsmrelmrvpvfnrcsatgwgqtnesirih qrtmtektkkqlaangkkihdngdlhhvhmsftdgkydgrylfmndkantrvarvrcdvm ktdaileipnakgihgmrpqkwprsnyvfcngedeaplvndgstmtdvatyvniftavda dkwevawqvkvsgnldncdadyegkwafstsynsemgmtleemtksemdhvvvfniaeie kaikagqyeeingvkvvdgrkeakslftryipiannphgcnmapdrkhlcvagklsptvt vldvtkfdalfydnaeprsavvaepelglgplhtafdgrgnaytslfldsqvvkwnidea irayagekinpikdkldvqyqpghlktvmgetldaandwlvclckfskdrflnvgplkpe ndqlidisgdkmvlvhdgptfaephdaiavspsilpnir
Timeline for d2iwfa1: