Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [225094] (5 PDB entries) |
Domain d2iwda_: 2iwd A: [204866] automated match to d1nrfa_ complexed with 1s6 |
PDB Entry: 2iwd (more details), 2.4 Å
SCOPe Domain Sequences for d2iwda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iwda_ e.3.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} dkyetnvsykklnqlapyfkgfdgsfvlynereqaysiynepeskqryspnstykiylal mafdqnllslnhteqqwdkhqypfkewnqdqnlnssmkysvnwyyenlnkhlrqdevksy ldlieygneeisgnenywnesslkisaieqvnllknmkqhnmhfdnkaiekvensmtlkq kdtykyvgktgtgivnhkeangwfvgyvetkdntyyfathlkgednangekaqqiseril kemeli
Timeline for d2iwda_: