Lineage for d2iwda_ (2iwd A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3015047Species Staphylococcus aureus [TaxId:1280] [225094] (5 PDB entries)
  8. 3015054Domain d2iwda_: 2iwd A: [204866]
    automated match to d1nrfa_
    complexed with 1s6

Details for d2iwda_

PDB Entry: 2iwd (more details), 2.4 Å

PDB Description: oxacilloyl-acylated mecr1 extracellular antibiotic-sensor domain.
PDB Compounds: (A:) methicillin resistance mecr1 protein

SCOPe Domain Sequences for d2iwda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iwda_ e.3.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
dkyetnvsykklnqlapyfkgfdgsfvlynereqaysiynepeskqryspnstykiylal
mafdqnllslnhteqqwdkhqypfkewnqdqnlnssmkysvnwyyenlnkhlrqdevksy
ldlieygneeisgnenywnesslkisaieqvnllknmkqhnmhfdnkaiekvensmtlkq
kdtykyvgktgtgivnhkeangwfvgyvetkdntyyfathlkgednangekaqqiseril
kemeli

SCOPe Domain Coordinates for d2iwda_:

Click to download the PDB-style file with coordinates for d2iwda_.
(The format of our PDB-style files is described here.)

Timeline for d2iwda_: