Lineage for d2iu0b2 (2iu0 B:201-593)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918664Family c.97.1.4: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64198] (2 proteins)
    duplication: consists of two domains of this fold with extra secondary structures within and in between the two core motifs
  6. 2918665Protein AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64199] (3 species)
  7. 2918666Species Chicken (Gallus gallus) [TaxId:9031] [64200] (9 PDB entries)
    Uniprot P31335
  8. 2918684Domain d2iu0b2: 2iu0 B:201-593 [204855]
    Other proteins in same PDB: d2iu0a1, d2iu0b1
    automated match to d1g8ma2
    complexed with 203, k

Details for d2iu0b2

PDB Entry: 2iu0 (more details), 2.53 Å

PDB Description: crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
PDB Compounds: (B:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d2iu0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iu0b2 c.97.1.4 (B:201-593) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]}
gvsqlplrygmnphqspaqlyttrpklpltvvngspgfinlcdalnawqlvkelkqalgi
paaasfkhvspagaavgiplseeeaqvcmvhdlhktltplasayarsrgadrmssfgdfi
alsdicdvptakiisrevsdgvvapgyeeealkilskkknggycvlqmdpnyepddneir
tlyglqlmqkrnnavidrslfknivtknktlpesavrdlivasiavkytqsnsvcyakdg
qvigigagqqsrihctrlagdkanswwlrhhprvlsmkfkagvkraevsnaidqyvtgti
gededlvkwqamfeevpaqlteaekkqwiakltavslssdaffpfrdnvdrakrigvqfi
vapsgsaadevvieacnelgitlihtnlrlfhh

SCOPe Domain Coordinates for d2iu0b2:

Click to download the PDB-style file with coordinates for d2iu0b2.
(The format of our PDB-style files is described here.)

Timeline for d2iu0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iu0b1