Lineage for d1fl3l1 (1fl3 L:2-113)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7258Species Blue fluorescent Fab 19G2, (mouse), kappa L chain [48906] (1 PDB entry)
  8. 7262Domain d1fl3l1: 1fl3 L:2-113 [20485]
    Other proteins in same PDB: d1fl3a2, d1fl3b2, d1fl3h2, d1fl3l2

Details for d1fl3l1

PDB Entry: 1fl3 (more details), 2.45 Å

PDB Description: crystal structure of the blue fluorescent antibody (19g2) in complex with stilbene hapten at 277k

SCOP Domain Sequences for d1fl3l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl3l1 b.1.1.1 (L:2-113) Immunoglobulin (variable domains of L and H chains) {Blue fluorescent Fab 19G2, (mouse), kappa L chain}
aaltqspvsnpvtlgtsasiscrstksllhsngitylywylqkpgqspqlliyqmsnlas
gvpnrfsssgsgtdftlrintveaedvgvyycaqnlelpptfgagtklelkr

SCOP Domain Coordinates for d1fl3l1:

Click to download the PDB-style file with coordinates for d1fl3l1.
(The format of our PDB-style files is described here.)

Timeline for d1fl3l1: