Lineage for d1fl3h1 (1fl3 H:2-116)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102259Species Blue fluorescent Fab 19G2, (mouse), kappa L chain [48906] (1 PDB entry)
  8. 102262Domain d1fl3h1: 1fl3 H:2-116 [20484]
    Other proteins in same PDB: d1fl3a2, d1fl3b2, d1fl3h2, d1fl3l2

Details for d1fl3h1

PDB Entry: 1fl3 (more details), 2.45 Å

PDB Description: crystal structure of the blue fluorescent antibody (19g2) in complex with stilbene hapten at 277k

SCOP Domain Sequences for d1fl3h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl3h1 b.1.1.1 (H:2-116) Immunoglobulin (variable domains of L and H chains) {Blue fluorescent Fab 19G2, (mouse), kappa L chain}
aallesggglvkpggslklsctasgitfsryimswvrqipekrlewvasissggityypd
svagrftisrdnvrnilylqmsslrsedtalyycargqgrpywgqgtsvtvsa

SCOP Domain Coordinates for d1fl3h1:

Click to download the PDB-style file with coordinates for d1fl3h1.
(The format of our PDB-style files is described here.)

Timeline for d1fl3h1: