Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Blue fluorescent Fab 19G2, (mouse), kappa L chain [48906] (1 PDB entry) |
Domain d1fl3h1: 1fl3 H:2-116 [20484] Other proteins in same PDB: d1fl3a2, d1fl3b2, d1fl3h2, d1fl3l2 |
PDB Entry: 1fl3 (more details), 2.45 Å
SCOP Domain Sequences for d1fl3h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fl3h1 b.1.1.1 (H:2-116) Immunoglobulin (variable domains of L and H chains) {Blue fluorescent Fab 19G2, (mouse), kappa L chain} aallesggglvkpggslklsctasgitfsryimswvrqipekrlewvasissggityypd svagrftisrdnvrnilylqmsslrsedtalyycargqgrpywgqgtsvtvsa
Timeline for d1fl3h1: