SCOPe 2.08: Domain d2io4d2: 2io4 D:128-245

Lineage for d2io4d2 (2io4 D:128-245)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [225354] (3 PDB entries)

8. Domain d2io4d2: 2io4 D:128-245 [204833]
   automated match to d1ud9a2
   complexed with ca, mpd

Details for d2io4d2

PDB Entry: 2io4, 2.6 Å

PDB Description: crystal structure of pcna12 dimer from sulfolobus solfataricus.

PDB Compounds: (D:) DNA polymerase sliding clamp c

SCOPe Domain Sequences for d2io4d2:

Sequence; same for both SEQRES and ATOM records:

>d2io4d2 d.131.1.0 (D:128-245) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
efpfkaqlltitfadiidelsdlgevlnihskenklyfevigdlstakvelstdngtlle
asgadvsssygmeyvanttkmrrasdsmelyfgsqiplklrfklpqegygdfyiapra

Timeline for d2io4d2:

• d2io4d2 first appeared in SCOPe 2.03
  
• d2io4d2 appears in SCOPe 2.07