SCOPe 2.03: Domain d1emth1: 1emt H:1-116

Lineage for d1emth1 (1emt H:1-116)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (177 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1emth1: 1emt H:1-116 [20483]
   Other proteins in same PDB: d1emth2, d1emtl1, d1emtl2
   part of anti-C60 fullerene Fab

Details for d1emth1

PDB Entry: 1emt, 2.25 Å

PDB Description: fab antibody fragment of an c60 antifullerene antibody

PDB Compounds: (H:) igg antibody (heavy chain)

SCOPe Domain Sequences for d1emth1:

Sequence; same for both SEQRES and ATOM records:

>d1emth1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvhlqesgpelvrpgasvkiscktsgyvfssswmnwvkqrpgqglkwigriypgngntny
nekfkgkatltadkssntaymqlssltsvdsavyfcatssaywgqgtlltvsa

Timeline for d1emth1:

• d1emth1 first appeared (with stable ids) in SCOP 1.55
  
• d1emth1 appears in SCOPe 2.02
  
• d1emth1 appears in SCOPe 2.04
  
• d1emth1 appears in the current release, SCOPe 2.08